Powered by FoodRisk.org

Allergen

1510259A

Accession 1510259A
Species Protobothrops flavoviridis
Common Name Pit-viper
Description H2 proteinase
Gi
Length 201
Year Adopted 2018
Sequence >accession|1510259A|H2 proteinase [Protobothrops flavoviridis]
ERFPQRYIELAIVVDHGMYKKYNQNSDKIKVRVHQMVNHINEMYRPLNIAISLNRLQIWS
KKDLITVKSASNVTLESFGNWRETVLLKQQNNDCAHLLTATNLNDNTIGLAYKKGMCNPK
LSVGLVQDYSPNVFMVAVTMTHELGHNLGMEHDDKDKCKCEACIMSDVISDKPSKLFSDC
SKNDYQTFLTKYNPQCILNAP