Powered by FoodRisk.org

Allergen

1A9V_A

Accession 1A9V_A
Species Dermatophagoides pteronyssinus
Common Name House dust mite
Description Chain A, Tertiary Structure Of The Major House Dust Mite Allergen Der P 2, Nmr, 10 Structures
IUIS Name
Gi 0157829757
Length 129
Year Adopted 2009
Sequence >1A9V_A Allergen Chain A, Tertiary Structure Of The Major House Dust Mite Allergen Der P 2, Nmr, 10 Structures [Dermatophagoides pteronyssinus]
SQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNTKTAKIEIKASIDG
LEVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVMGDDGVLACA
IATHAKIRD
Parent Accession