Powered by FoodRisk.org

Allergen

1B6F_A

Accession 1B6F_A
Species Betula pendula
Common Name European white birch
Description Chain A, Birch Pollen Allergen Bet V 1
IUIS Name
Gi 0159162097
Length 159
Year Adopted 2009
Sequence >1B6F_A Allergen Chain A, Birch Pollen Allergen Bet V 1 [Betula pendula]
GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE
GFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNKY
HTKGDHEVKAEQVKASKELGETLLRAVESYLLAHSDAYN
Parent Accession