Powered by FoodRisk.org

Allergen

1CQA_A

Accession 1CQA_A
Species Betula pendula
Common Name European white birch
Description profilin
IUIS Name Bet v 2
Gi 0157830684
Length 133
Year Adopted 2009
Sequence >1CQA_A Allergen Bet v 2; profilin [Betula pendula]
MSWQTYVDEHLMCDIDGQGEELAASAIVGHDGSVWAQSSSFPQFKPQEITGIMKDFEEPG
HLAPTGLHLGGIKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV
VERLGDYLIDQGL
Parent Accession