Powered by FoodRisk.org

Allergen

1ESF_B

Accession 1ESF_B
Species Staphylococcus aureus
Common Name Bacteria
Description Chain B, Staphylococcal Enterotoxin A
IUIS Name
Gi 0001633233
Length 233
Year Adopted 2009
Sequence >1ESF_B Allergen Chain B, Staphylococcal Enterotoxin A [Staphylococcus aureus]
SEKSEEINEKDLRKKSELQGTALGNLKQIYYYNEKAKTENKESHDQFLQHTILFKGFFTD
HSWYNDLLVDFDSKDIVDKYKGKKVDLYGAYYGYQCAGGTPNKTACMYGGVTLHDNNRLT
EEKKVPINLWLDGKQNTVPLETVKTNKKNVTVQELDLQARRYLQEKYNLYNSDVFDGKVQ
RGLIVFHTSTEPSVNYDLFGAQGQYSNTLLRIYRDNKTINSENMHIDIYLYTS
Parent Accession