Powered by FoodRisk.org

Allergen

1G5U_A

Accession 1G5U_A
Species Hevea brasiliensis
Common Name Para rubber tree
Description Profilin
IUIS Name Hev b 8
Gi 0011513601
Length 131
Year Adopted 2007
Sequence >1G5U_A Allergen Hev b 8; profilin [Hevea brasiliensis]
MSWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAVMKDFDEPGSL
APTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKRTGQALIIGIYDEPLTPGQCNMIVE
RLGDYLLDQGL
Parent Accession