Powered by FoodRisk.org

Allergen

1H2O_A

Accession 1H2O_A
Species Prunus avium
Common Name Cherry
Description Chain A, Solution Structure Of The Major Cherry Allergen Pru Av 1 Mutant E45w
IUIS Name
Gi 0159162378
Length 159
Year Adopted 2009
Sequence >1H2O_A Allergen Chain A, Solution Structure Of The Major Cherry Allergen Pru Av 1 Mutant E45w [Prunus avium]
GVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILWGDGGPGTIKKITFGE
GSQYGYVKHKIDSIDKENYSYSYTLIEGDALGDTLEKISYETKLVASPSGGSIIKSTSHY
HTKGNVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN
Parent Accession