Powered by FoodRisk.org

Allergen

1JTI_A

Accession 1JTI_A
Species Gallus gallus
Common Name Chicken
Description Ovalbumin
IUIS Name Gal d 2
Gi 0015826578
Length 385
Year Adopted 2007
Sequence >1JTI_A Allergen Gal d 2; ovalbumin [Gallus gallus]
GSIGAASMEFCFDVFKELKVHHANENIFYCPIAIMSALAMVYLGAKDSTRTQINKVVRFD
KLPGFGDSIEAQCGTSVNVHSSLRDILNQITKPNDVYSFSLASRLYAEERYPILPEYLQC
VKELYRGGLEPINFQTAADQARELINSWVESQTNGIIRNVLQPSSVDSQTAMVLVNAIVF
KGLWEKTFKDEDTQAMPFRVTEQESKPVQMMYQIGLFRVASMASEKMKILELPFASGTMS
MLVLLPDEVSGLEQLESIINFEKLTEWTSSNVMEERKIKVYLPRMKMEEKYNLTSVLMAM
GITDVFSSSANLSGISSAESLKISQAVHAAHAEINEAGTEVVGSAEAGVDAASVSEEFRA
DHPFLFCIKHIATNAVLFFGRCVSP
Parent Accession