Powered by FoodRisk.org

Allergen

1KTJ_A

Accession 1KTJ_A
Species Dermatophagoides pteronyssinus
Common Name House dust mite
Description Chain A, X-Ray Structure Of Der P 2, The Major House Dust Mite Allergen
IUIS Name
Gi 0021465915
Length 129
Year Adopted 2007
Sequence >1KTJ_A Allergen Chain A, X-Ray Structure Of Der P 2, The Major House Dust Mite Allergen [Dermatophagoides pteronyssinus]
SEVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNTKTAKIEIKASIDG
LEVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVMGDDGVLACA
IATHAKIRD
Parent Accession