Powered by FoodRisk.org

Allergen

1L3P_A

Accession 1L3P_A
Species Phleum pratense
Common Name Common timothy
Description ribonuclease
IUIS Name Phl p 5
Gi 0028948464
Length 102
Year Adopted 2007
Sequence >1L3P_A Allergen Phl p 5; ribonuclease [Phleum pratense]
IPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKETTGGAYDTYKCIPSL
EAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVSQ
Parent Accession