Powered by FoodRisk.org

Allergen

1LLT_A

Accession 1LLT_A
Species Betula pendula
Common Name European white birch
Description Chain A, Birch Pollen Allergen Bet V 1 Mutant E45s
IUIS Name
Gi 0038492423
Length 159
Year Adopted 2007
Sequence >1LLT_A Allergen Chain A, Birch Pollen Allergen Bet V 1 Mutant E45s [Betula pendula]
GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENISGNGGPGTIKKISFPE
GLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNKY
HTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN
Parent Accession