Powered by FoodRisk.org

Allergen

1NLX_N

Accession 1NLX_N
Species Phleum pratense
Common Name Common timothy
Description Chain N, Crystal Structure Of Phl P 6, A Major Timothy Grass Pollen Allergen Co-Crystallized With Zinc
IUIS Name
Gi 0028374072
Length 111
Year Adopted 2007
Sequence >1NLX_N Allergen Chain N, Crystal Structure Of Phl P 6, A Major Timothy Grass Pollen Allergen Co-Crystallized With Zinc [Phleum pratense]
MGKATTEEQKLIEDVNASFRAAMATTANVPPADKYKTFEAAFTVSSKRNLADAVSKAPQL
VPKLDEVYNAAYNAADHAAPEDKYEAFVLHFSEALRIIAGTPEVHAVKPGA
Parent Accession