Powered by FoodRisk.org

Allergen

1QMR_A

Accession 1QMR_A
Species Betula pendula
Common Name European white birch
Description Chain A, Birch Pollen Allergen Bet V 1 Mutant N28t, K32q, E45s, P108g
IUIS Name
Gi 0011514622
Length 159
Year Adopted 2007
Sequence >1QMR_A Allergen Chain A, Birch Pollen Allergen Bet V 1 Mutant N28t, K32q, E45s, P108g [Betula pendula]
GVFNYETETTSVIPAARLFKAFILDGDTLFPQVAPQAISSVENISGNGGPGTIKKISFPE
GLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATGDGGSILKISNKY
HTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN
Parent Accession