Powered by FoodRisk.org

Allergen

1QNX_A

Accession 1QNX_A
Species Vespula vulgaris
Common Name Wasp
Description Chain A, Ves V 5, An Allergen From Vespula Vulgaris Venom
IUIS Name
Gi 0011514279
Length 209
Year Adopted 2007
Sequence >1QNX_A Allergen Chain A, Ves V 5, An Allergen From Vespula Vulgaris Venom [Vespula vulgaris]
AEAEFNNYCKIKCLKGGVHTACKYGSLKPNCGNKVVVSYGLTKQEKQDILKEHNDFRQKI
ARGLETRGNPGPQPPAKNMKNLVWNDELAYVAQVWANQCQYGHDTCRDVAKYQVGQNVAL
TGSTAAKYDDPVKLVKMWEDEVKDYNPKKKFSGNDFLKTGHYTQMVWANTKEVGCGSIKY
IQEKWHKHYLVCNYGPSGNFKNEELYQTK
Parent Accession