Powered by FoodRisk.org

Allergen

1UHG_D

Accession 1UHG_D
Species Gallus gallus
Common Name Chicken
Description Chain D, Crystal Structure Of S-Ovalbumin At 1.9 Angstrom Resolution
Gi 0034811333
Length 385
Year Adopted 2007
Sequence >accession|1UHG_D|Allergen Chain D, Crystal Structure Of S-Ovalbumin At 1.9 Angstrom Resolution [Gallus gallus]
GSIGAASMEFCFDVFKELKVHHANENIFYCPIAIMSALAMVYLGAKDSTRTQINKVVRFD
KLPGFGDXIEAQCGTSVNVHSSLRDILNQITKPNDVYSFSLASRLYAEERYPILPEYLQC
VKELYRGGLEPINFQTAADQARELINSWVESQTNGIIRNVLQPXSVDSQTAMVLVNAIVF
KGLWEKAFKDEDTQAMPFRVTEQESKPVQMMYQIGLFRVASMASEKMKILELPFAXGTMS
MLVLLPDEVSGLEQLESIINFEKLTEWTSSNVMEERKIKVYLPRMKMEEKYNLTSVLMAM
GITDVFSSSANLSGISSAEXLKISQAVHAAHAEINEAGREVVGXAEAGVDAASVSEEFRA
DHPFLFCIKHIATNAVLFFGRCVSP