Powered by FoodRisk.org

Allergen

1W2Q_A

Accession 1W2Q_A
Species Arachis hypogaea
Common Name Peanut
Description Chain A, Allergen Arah6 From Peanut (Arachis Hypogaea)
IUIS Name
Gi 0159163254
Length 127
Year Adopted 2009
Sequence >1W2Q_A Allergen Chain A, Allergen Arah6 From Peanut (Arachis Hypogaea) [Arachis hypogaea]
GPMRRERGRQGDSSSCERQVDRVNLKPCEQHIMQRIMGEQEQYDSYDIRSTRSSDQQQRC
CDELNEMENTQGCMCEALQQIMENQCDRLQDRQMVQQFKRELMSLPQQCNFRAPQRCDLD
VSGGRCS
Parent Accession