Powered by FoodRisk.org

Allergen

1WKX_A

Accession 1WKX_A
Species Hevea brasiliensis
Common Name Para rubber tree
Description Chain A, Crystal Structure Of A Hev B 6.02 Isoallergen
IUIS Name
Gi 0073535415
Length 43
Year Adopted 2007
Sequence >1WKX_A Allergen Chain A, Crystal Structure Of A Hev B 6.02 Isoallergen [Hevea brasiliensis]
EQCGRQAGGKLCPDNLCCSQWGWCGSTDEYCSPDHNCQSNCKD
Parent Accession