Powered by FoodRisk.org

Allergen

1YG9_A

Accession 1YG9_A
Species Blattella germanica
Common Name German cockroach
Description Chain A, The Structure Of Mutant (N93q) Of Bla G 2
IUIS Name
Gi 0062738637
Length 330
Year Adopted 2007
Sequence >1YG9_A Allergen Chain A, The Structure Of Mutant (N93q) Of Bla G 2 [Blattella germanica]
GASIVPLYKLVHVFINTQYAGITKIGNQNFLTVFDSTSCNVVVASQECVGGACVCPNLQK
YEKLKPKYISDGNVQVKFFDTGSAVGRGIEDSLTISQLTTSQQDIVLADELSQEVCILSA
DVVVGIAAPGCPNALKGKTVLENFVEENLIAPVFSIHHARFQDGEHFGEIIFGGSDWKYV
DGEFTYVPLVGDDSWKFRLDGVKIGDTTVAPAGTQAIIDTSKAIIVGPKAYVNPINEAIG
CVVEKTTTRRICKLDCSKIPSLPDVTFVINGRNFNISSQYYIQQNGNLCYSGFQPXGHSD
HFFIGDFFVDHYYSEFNWENKTMGFGRSVE
Parent Accession