Powered by FoodRisk.org

Allergen

1Z3Q_A

Accession 1Z3Q_A
Species Musa acuminata
Common Name Banana
Description thaumatin-like protein (TLP)
IUIS Name Mus a 4
Gi 0088191901
Length 200
Year Adopted 2007
Sequence >1Z3Q_A Allergen Mus a 4; thaumatin-like protein (TLP) [Musa acuminata]
ATFEIVNRCSYTVWAAAVPGGGRQLNQGQSWTINVNAGTTGGRIWGRTGCSFDGSGRGRC
QTGDCGGVLSCTAYGNPPNTLAEFALNQFNNLDFFDISLVDGFNVPMDFSPTSGGCRGIR
CAADINGQCPGALKAPGGCNNPCTVFKTDQYCCNSGACSPTDYSQFFKRNCPDAYSYPKD
DQTTTFTCPGGTNYRVVFCP
Parent Accession