Powered by FoodRisk.org

Allergen

2008179A

Accession 2008179A
Species Parietaria judaica
Common Name Weed
Description major allergen Par j I
IUIS Name
Gi 0000741844
Length 143
Year Adopted 2007
Sequence >2008179A Allergen major allergen Par j I [Parietaria judaica]
MVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGK
LVSEVPKHCGIVDSKLPPIDVNMDCKTVGVVPRQPQLPVSLRHGPVTGPSRSRPPTKHGW
RDPRLEFRPPHRKKPNPAFSTLG
Parent Accession