Powered by FoodRisk.org

Allergen

2023228A

Accession 2023228A
Species Phleum pratense
Common Name Common timothy
Description major allergen Phl p Va
IUIS Name
Gi 0001092249
Length 285
Year Adopted 2007
Sequence >2023228A Allergen major allergen Phl p Va [Phleum pratense]
ADLGYGPATPAAPAAGYTPATPAAPAGADAAGKATTEEQKLIEKINAGFKAALAGAGVQP
ADKYRTFVATFGPASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPE
AKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANA
APANDKFTVFEAAFNDEIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFET
ALKKAITAMSEAQKAAKPPPLPPPPQPPPLAATGAATAATGGYKV
Parent Accession