Powered by FoodRisk.org

Allergen

2103117A

Accession 2103117A
Species Dactylis glomerata
Common Name Orchard grass
Description allergen Dac g II
Gi 0001093120
Length 196
Year Adopted 2007
Sequence >accession|2103117A|Putative allergen Dac g II [Dactylis glomerata]
EAPVTFTVEKGSDEKNLALSIKYNKEGDSMAEVELKEHGSNEWLALKKNGDGVWEIKSDK
PLKGPFNFRFVSEKGMRNVFVDVVPADFKVGTTYKPEEAAASASRRRSSEVFQFLILSCQ
GRIVNNCEVLICVMRRGNAMCLIASISMHHILTLDRFFFDGLEIIYKIFKMMFQKPRTRT
CIEKDFPRRSSSSIPT