Allergen

2118249A

Accession 2118249A
Species Lepidoglyphus destructor
Common Name Storage mite
Description allergen Lep d 1.01
IUIS Name
Gi 0001582222
Length 141
Year Adopted 2007
Sequence >2118249A Putative allergen Lep d 1.01 [Lepidoglyphus destructor]
MMKFIALFALVAVASAGKMTFKDCGHGEVTELDITGCSGDTCVIHRGEKMTLEAKFAANQ
DTAKVTIKVLAKVAGTTIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVKADV
TAELIGDHGVMACGTVHGVQE
Parent Accession