Powered by FoodRisk.org

Allergen

4X9U_A

Accession 4X9U_A
Species Actinidia deliciosa
Common Name Kiwifruit
Description Chain A, Crystal Structure of The Kiwifruit Allergen Act D 5
Gi 0906848987
Length 189
Year Adopted 2017
Sequence >accession|4X9U_A|Chain A, Crystal Structure Kiwifruit Allergen Act D 5 [Actinidia deliciosa]
ISSCNGPCRDLNDCDGQLICIKGKCNDDPQVGTHICRGTTXSXQPGGCKPSGTLTCRGKS
HPTYDCSPPVTSSTPAKLTNNDFSEGGDDGGPSECDESYHNNNERIVALSTGWYNGGSRC
GKMIRITASNGKSVSAKVVDECDSRHGCDKEHAGQPPCRNNIVDGSNAVWSALGLDKNVG
VVDITWSMA