Powered by FoodRisk.org

Allergen

5X7Y_A

Accession 5X7Y_A
Species Canis lupus familiaris
Common Name Dog
Description Lipocalin, putative Can f 6, Chain A
Gi
Length 177
Year Adopted 2019
Sequence >accession|5X7Y_A|Lipocalin, putative Can f 6, Chain A [Canis lupus familiaris]
GSHEEENDVVKGNFDISKISGDWYSILLASDIKEKIEENGSMRVFVKDIEVLSNSSLIFT
MHTKVNGKCTKISLICNKTEKDGEYDVVHDGYNLFRIIETAYEDYIIFHLNNVNQEQEFQ
LMELYGRKPDVSPKVKEKFVRYCQGMEIPKENILDLTQVDRCLQARQSEAAQVSSAE