Allergen

AAA20068.1

Accession AAA20068.1
Species Ambrosia psilostachya
Common Name Western ragweed
Description Amb p V allergen
IUIS Name
Gi 0000515957
Length 77
Year Adopted 2007
Sequence >AAA20068.1 Allergen Amb p V allergen [Ambrosia psilostachya]
MNNEKNVSFEFIGSTNEVDEIKVMACYAAGSICGEKRGYCCTNPGRYCPWQVVCYESRKI
CAKNAAKMRMNVTKNTI
Parent Accession