Allergen

AAA32970.1

Accession AAA32970.1
External DB Link NCBI Protein
Species Hordeum vulgare
Common Name barley
Description lipid transfer protein
IUIS Name
Length 117
Year Adopted 2007
Sequence >AAA32970.1 lipid transfer protein [Hordeum vulgare]
MARAQVLLMAAALVLMLTAAPRAAVALNCGQVDSKMKPCLTYVQGGPGPSGECCNGVRDL
HNQAQSSGDRQTVCNCLKGIARGIHNLNLNNAASIPSKCNVNVPYTISPDIDCSRIY
Parent Accession

Related Articles

Pubmed Authors Title Journal
1536930 Skriver,K.; Leah,R.; Muller-Uri,F.; Olsen,F.L.; Mundy,J. Structure and expression of the barley lipid transfer protein gene Ltp1 Plant Mol. Biol. 18 (3), 585-589 (1992)
11031346 Pastorello EA; Farioli L; Pravettoni V; Ispano M; Scibola E; Trambaioli C; Giuffrida MG; Ansaloni R; Godovac-Zimmermann J; Conti A; Fortunato D; Ortolani C The maize major allergen, which is responsible for food-induced allergic reactions, is a lipid transfer protein. J Allergy Clin Immunol. 2000 Oct;106(4):744-51
11590395 Garcia-Casado G; Crespo JF; Rodriguez J; Salcedo G Isolation and characterization of barley lipid transfer protein and protein Z as beer allergens. J Allergy Clin Immunol. 2001 Oct;108(4):647-9
11476466 Asero R; Mistrello G; Roncarolo D; Amato S; van Ree R A case of allergy to beer showing cross-reactivity between lipid transfer proteins. Ann Allergy Asthma Immunol. 2001 Jul;87(1):65-7