Allergen

AAA33947.1

Accession AAA33947.1
External DB Link NCBI Protein
Species Glycine max
Common Name soybean
Description 7S globulin, vicilin, beta-conglycinin
IUIS Name Gly m 5
Length 218
Year Adopted 2007
Sequence >AAA33947.1 Gly m 5; 7S globulin, vicilin, beta-conglycinin [Glycine max]
SKRAKSSSRKTISSEDKPFNLGSRDPIYSKKLGKFFEITPEKNPQLRDLDIFLSIVDMNE
GALLLPHFNSKAIVILVINEGDANIELVGLKEQQQEQQQEEQPLEVRKYRAELSEQDIFV
IPAGYPVVVNATSNLNFFAIGINAENNQRNFLAGSQDNVISQIPSQVQELAFPGSAQAVE
KLLKNQRESYFVDAQPNEKEEGNKGRKGPLSSILRAFY
Parent Accession

Related Articles

Pubmed Authors Title Journal
2103438 Sebastiani,F.L.; Farrell,L.B.; Schuler,M.A.; Beachy,R.N. Complete sequence of a cDNA of alpha subunit of soybean beta-conglycinin Plant Mol. Biol. 15 (1), 197-201 (1990)
2562562 Harada,J.J.; Barker,S.J.; Goldberg,R.B. Soybean beta-conglycinin genes are clustered in several DNA regions and are regulated by transcriptional and posttranscriptional processes Plant Cell 1 (4), 415-425 (1989)
7787297 Ogawa T; Bando N; Tsuji H; Nishikawa K; Kitamura K Alpha-subunit of beta-conglycinin, an allergenic protein recognized by IgE antibodies of soybean-sensitive patients with atopic dermatitis. Biosci Biotechnol Biochem. 1995 May;59(5):831-3
12105965 Maruyama N; Mohamed Salleh MR; Takahashi K; Yagasaki K; Goto H; Hontani N; Nakagawa S; Utsumi S Structure-physicochemical function relationships of soybean beta-conglycinin heterotrimers. J Agric Food Chem. 2002 Jul 17;50(15):4323-6
11434464 Yoshino,M.; Kanazawa,A.; Tsutsumi,K.I.; Nakamura,I.; Shimamoto,Y.; Structure and characterization of the gene encoding alpha subunit of soybean beta-conglycinin Genes Genet. Syst. 76 (2), 99-105 (2001)
24416141 Curciarello R; Smaldini PL; Candreva AM; González V; Parisi G; Cauerhff A; Barrios I; Blanch LB; Fossati CA; Petruccelli S; Docena GH Targeting a cross-reactive Gly m 5 soy peptide as responsible for hypersensitivity reactions in a milk allergy mouse model. PLoS One. 2014;9(1):e82341
18996574 Holzhauser T; Wackermann O; Ballmer-Weber BK; Bindslev-Jensen C; Scibilia J; Perono-Garoffo L; Utsumi S; Poulsen LK; Vieths S Soybean (Glycine max) allergy in Europe: Gly m 5 (beta-conglycinin) and Gly m 6 (glycinin) are potential diagnostic markers for severe allergic reactions to soy. J Allergy Clin Immunol. 2009 Feb;123(2):452-8
19128355 Adachi A; Horikawa T; Shimizu H; Sarayama Y; Ogawa T; Sjolander S; Tanaka A; Moriyama T Soybean beta-conglycinin as the main allergen in a patient with food-dependent exercise-induced anaphylaxis by tofu: food processing alters pepsin resistance. Clin Exp Allergy. 2009 Jan;39(1):167-73