Allergen

AAA62707.1

Accession AAA62707.1
Species Bos taurus
Common Name Bovine
Description alpha-s1-casein
IUIS Name
Gi 0000162650
Length 93
Year Adopted 2007
Sequence >AAA62707.1 Allergen alpha-s1-casein [Bos taurus]
PQLEIVPNSAEERLHSMKEGIHAQQKEPMIGVNQELAYFYPELFRQFYQLDAYPSGAWYY
VPLGTQYTDAPSFSDIPNPIGLENSEKTTMPLW
Parent Accession