Allergen

AAA63278.1

Accession AAA63278.1
Species Lolium perenne
Common Name Perennial ryegrass
Description beta expansin
IUIS Name Lol p 1
Gi 0000168314
Length 252
Year Adopted 2007
Sequence >AAA63278.1 Allergen Lol p 1; beta expansin [Lolium perenne]
ALFAVFLGSAHGIAKVPPGPNITAEYGDKWLDAKSTWYGKPTGAGPKDNGGACGYKDVDK
APFNGMTGCGNTPIFKDGRGCGSCFEIKCTKPESCSGEAVTVTITDDNEEPIAPYHFDLS
GHAFGSMAKKGEEQNVRSAGELELQFRRVKCKYPDDTKPTFHVEKGSNPNYLAILVKYVD
GDGDVVAVDIKEKGKDKWIELKESWGAVWRIDTPDKLTGPFTVRYTTEGGTKSEVEDVIP
EGWKADTSYSAK
Parent Accession