Allergen

AAA68279.1

Accession AAA68279.1
Species Dolichovespula maculata
Common Name Whiteface hornet
Description hyaluronidase
IUIS Name Dol m 2
Gi 0000511604
Length 331
Year Adopted 2011
Sequence >AAA68279.1 Allergen Dol m 2; hyaluronidase [Dolichovespula maculata]
SERPKRVFNIYWNVPTFMCHQYGLYFDEVTNFNIKHNSKDDFQGDKISIFYDPGEFPALL
PLKEGNYKIRNGGVPQEGNITIHLQRFIENLDKTYPNRNFNGIGVIDFERWRPIFRQNWG
NMMIHKKFSIDLVRNEHPFWDKKMIELEASKRFEKYARLFMEETLKLAKKTRKQADWGYY
GYPYCFNMSPNNLVPDCDATAMLENDKMSWLFNNQNVLLPSVYIRHELTPDQRVGLVQGR
VKEAVRISNNLKHSPKVLSYWWYVYQDDTNTFLTETDVKKTFQEIAINGGDGIIIWGSSS
DVNSLSKCKRLREYLLTVLGPITVNVTETVN
Parent Accession