Powered by FoodRisk.org

Allergen

AAA87456.1

Accession AAA87456.1
Species Hevea brasiliensis
Common Name Para rubber tree
Description beta-1,3-glucanase
IUIS Name Hev b 2
Gi 0001184668
Length 374
Year Adopted 2007
Sequence >AAA87456.1 Allergen Hev b 2; beta-1,3-glucanase [Hevea brasiliensis]
MAISSSTSGTSSSFPSRTTVMLLLFFFAASVGITDAQVGVCYGMQGNNLPPVSEVIALYK
KSNITRMRIYDPNRAVLEALRGSNIELILGVPNSDLQSLTNPSNAKSWVQKNVRGFWSSV
LFRYIAVGNEISPVNRGTAWLAQFVLPAMRNIHDAIRSAGLQDQIKVSTAIDLTLVGNSY
PPSAGAFRDDVRSYLDPIIGFLSSIRSPLLANIYPYFTYAYNPRDISLPYALFTSPSVVV
WDGQRGYKNLFDATLDALYSALERASGGSLEVVVSESGWPSAGAFAATFDNGRTYLSNLI
QHVKGGTPKRPNRAIETYLFAMFDENKKQPEVEKHFGLFFPDKRPKYNLNFGAEKNWDIS
TEHNATILFLKSDM
Parent Accession