Powered by FoodRisk.org

Allergen

AAA87851.1

Accession AAA87851.1
Species Blattella germanica
Common Name German cockroach
Description allergen Bla g 4
Gi 0001166573
Length 182
Year Adopted 2007
Sequence >accession|AAA87851.1|Allergen allergen Bla g 4 [Blattella germanica]
AVLALCATDTLANEDCFRHESLVPNLDYERFRGSWIIAAGTSEALTQYKCWIDRFSYDDA
LVSKYTDSQGKNRTTIRGRTKFEGNKFTIDYNDKGKAFSAPYSVLATDYENYAIVEGCPA
AANGHVIYVQIRFSVRRFHPKLGDKEMIQHYTLDQVNQHKKAIEEDLKHFNLKYEDLHST
CH