Allergen

AAB01374.1

Accession AAB01374.1
Species Glycine max
Common Name Soybean
Description beta-conglycinin storage protein [Glycine max]
IUIS Name
Gi 0000169929
Length 639
Year Adopted 2007
Sequence >AAB01374.1 Putative beta-conglycinin storage protein [Glycine max]
MMRARFPLLLLGVVFLASVSVSFGIAYWEKQNPSHNKCLRSCNSEKDSYRNQACHARCNL
LKVEEEEECEEGQIPRPRPQHPERERQQHGEKEEDEGEQPRPFPFPRPRQPHQEEEHEQK
EEHEWHRKEEKHGGKGSEEEQDEREHPRPHQPHQKEEEKHEWQHKQEKHQGKESEEEEED
QDEDEEQDKESQESEGSESQREPRRHKNKNPFHFNSKRFQTLFKNQYGHVRVLQRFNKRS
QQLQNLRDYRILEFNSKPNTLLLPHHADADYLIVILNGTAILTLVNNDDRDSYNLQSGDA
LRVPAGTTFYVVNPDNDENLRMIAGTTFYVVNPDNDENLRMITLAIPVNKPGRFESFFLS
STQAQQSYLQGFSKNILEASYDTKFEEINKVLFGREEGQQQGEERLQESVIVEISKKQIR
ELSKHAKSSSRKTISSEDKPFNLGSRDPIYSNKLGKLFEITQRNPQLRDLDVFLSVVDMN
EGALFLPHFNSKAIVVLVINEGEANIELVGIKEQQQRQQQEEQPLEVRKYRAELSEQDIF
VIPAGYPVMVNATSDLNFFAFGINAENNQRNFLAGSKDNVISQIPSQVQELAFPRSAKDI
ENLIKSQSESYFVDAQPQQKEEGNKGRKGPLSSILRAFY
Parent Accession