Allergen

AAB22817.1

Accession AAB22817.1
Species Arachis hypogaea
Common Name Peanut
Description peanut agglutinin precursor; prePNA [Arachis hypogaea]
IUIS Name
Gi 0000253289
Length 273
Year Adopted 2007
Sequence >AAB22817.1 Putative peanut agglutinin precursor; prePNA [Arachis hypogaea]
MKPFCVFLTFFLLLAASSKKVDSAETVSFNFNSFSEGNPAINFQGDVTVLSNGNIQLTNL
NKVNSVGRVLYAMPVRIWSSATGNVASFLTSFSFEMKDIKDYDPADGIIFFIAPEDTQIP
AGSIGGGTLGVSDTKGAGHFVGVEFDTYSNSEYNDPPTDHVGIDVNSVDSVKTVPWNSVS
GAVVKVTVIYDSSTKTLSVAVTNDNGDITTIAQVVDLKAKLPERVKFGFSASGSLGGRQI
HLIRSWSFTSTLITTTRRSIDNNEKKIMNMASA
Parent Accession