Allergen

AAB23464.1

Accession AAB23464.1
Species Glycine max
Common Name Soybean
Description Kunitz trypsin inhibitor; KTi [Glycine max]
IUIS Name
Gi 0000256429
Length 216
Year Adopted 2007
Sequence >AAB23464.1 Putative Kunitz trypsin inhibitor; KTi [Glycine max]
MKSTIFFLFLFCAFTTSYLPSAIADFVLDNEGNPLENGGTYYILSDITAFGGIRAAPTGN
ERCPLTVVQSRNELDKGIGTIISSPYRIRFIAEGHPLSLKFDSFAVIMLCVGIPTEWSVV
EDLPEGPAVKIGENKDAMDGWFRLERVSDDEFNNYKLVFCPQQAEDDKCGDIGISIDHDD
GTRRLVVSKNKPLVVQFQKLDKESLAKKNHGLSRSE
Parent Accession