Allergen

AAB23482.1

Accession AAB23482.1
Species Glycine max
Common Name Soybean
Description Kunitz trypsin inhibitor KTi1 [Glycine max]
IUIS Name
Gi 0000256635
Length 203
Year Adopted 2007
Sequence >AAB23482.1 Putative Kunitz trypsin inhibitor KTi1 [Glycine max]
MKSTIFFALFLVCAFTISYLPSATAQFVLDTDDDPLQNGGTYYMLPVMRGKGGGIEVDST
GKEICPLTVVQSPNELDKGIGLVFTSPLHALFIAERYPLSIKFGSFAVITLCAGMPTEWA
IVEREGLQAVKLAARDTVDGWFNIERVSREYNDYKLVFCPQQAEDNKCEDIGIQIDDDGI
RRLVLSKNKPLVVQFQKFRSSTA
Parent Accession