Powered by FoodRisk.org

Allergen

AAB24432.1

Accession AAB24432.1
Species Alnus glutinosa
Common Name Alder
Description Aln g I [Alnus glutinosa]
IUIS Name
Gi 0000261407
Length 160
Year Adopted 2007
Sequence >AAB24432.1 Allergen Aln g I [Alnus glutinosa]
MGVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFP
EGSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNK
FHTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN
Parent Accession