Allergen

AAB32224.1

Accession AAB32224.1
External DB Link NCBI Protein
Species Dermatophagoides pteronyssinus
Common Name house dust mite
Description glutathione S-transferase
IUIS Name Der p 8
Length 219
Year Adopted 2007
Sequence >AAB32224.1 Der p 8; glutathione S-transferase [Dermatophagoides pteronyssinus]
MSQPILGYWDIRGYAQPIRLLLTYSGVDFVDKRYQIGPAPDFDRSEWLNEKFNLGLDFPN
LPYYIDGDMKMTQTFAILRYLGRKYKLNGSNDHEEIRISMAEQQTEDMMAAMIRVCYDAN
CDKLKPDYLKSLPDCLKLMSKFVGEHAFIAGANISYVDFNLYEYLCHVKVMVPEVFGQFE
NLKRYVERMESLPRVSDYIKKQQPKTFNAPTSKWNASYA
Parent Accession

Related Articles

Pubmed Authors Title Journal
7918651 O'Neill,G.M.; Donovan,G.R.; Baldo,B.A. Cloning and characterization of a major allergen of the house dust mite, Dermatophagoides pteronyssinus, homologous with glutathione S-transferase Biochim. Biophys. Acta 1219 (2), 521-528 (1994)
8719107 O Glutathione S-transferase a major allergen of the house dust mite, Dermatophagoides pteronyssinus. Immunol Lett. 1995 Dec;48(2):103-7
16282315 Dougall A; Holt DC; Fischer K; Currie BJ; Kemp DJ; Walton SF Identification and characterization of Sarcoptes scabiei and Dermatophagoides pteronyssinus glutathione S-transferases: implication as a potential major allergen in crusted scabies. Am J Trop Med Hyg. 2005 Nov;73(5):977-84
18220991 Thomas WR; Heinrich TK; Smith WA; Hales BJ Pyroglyphid house dust mite allergens. Protein Pept Lett. 2007;14(10):943-53