Allergen

AAB34785.1

Accession AAB34785.1
Species Penicillium chrysogenum
Common Name Fungus
Description N-acetyl glucosaminidase / N-acetyl hexosaminidase
IUIS Name Pen ch 20
Gi 0000999009
Length 117
Year Adopted 2007
Sequence >AAB34785.1 Allergen Pen ch 20; N-acetyl glucosaminidase / N-acetyl hexosaminidase [Penicillium chrysogenum]
GPYKTWQRIYDYDFLTNLTSSEANDIIGAEAPLWSEQVDDVTVSSVFWPRAAALGELVWS
GNRDAAGRKRTTSFTQRILNFREYLVANGVMAAALVPKYCLQHPHACDLYKNQTVMS
Parent Accession