Allergen

AAB34909.1

Accession AAB34909.1
Species Carpinus betulus
Common Name Hornbeam
Description group 2 Car b 1=isoallergenic variant [Carpinus betulus=hornbeams, pollen, Peptide Recombinant Partial, 80 aa]
IUIS Name
Gi 0001008580
Length 80
Year Adopted 2012
Sequence >AAB34909.1 Allergen group 2 Car b 1=isoallergenic variant [Carpinus betulus]
GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQVVSSVENVEGNGGPGTIKKITFSE
GIPVKYVKERVEEIDHTNFK
Parent Accession