Allergen

AAB35977.1

Accession AAB35977.1 (Retired)
External DB Link NCBI Protein
Species Dermatophagoides farinae
Common Name house dust mite
Description bactericidal permeability-increasing like
IUIS Name Der f 7
Length 213
Year Adopted 2010
Sequence >AAB35977.1 Allergen Der f 7; bactericidal permeability-increasing like [Dermatophagoides farinae]
MMKFLLIAAVAFVAVSADPIHYDKITEEINKAIDDAIAAIEQSETIDPMKVPDHADKFER
HVGIVDFKGELAMRNIEARGLKQMKRQGDANVKGEEGIVKAHLLIGVHDDIVSMEYDLAY
KLGDLHPTTHVISDIQDFVVALSLEISDEGNITMTSFEVRQFANVVNHIGGLSILDPIFG
VLSDVLTAIFQDTVRKEMTKVLAPAFKRELEKN
Parent Accession
Notes Another sequence in the list of new additions (originally named COMPARE76 in the metadata file) is an exact match and will be listed with accession AAB35977.1 This old entry, AAB35977.1 (entry date 2010), had the wrong species listed reason why the 2010 is deleted, being replaced with the AAB35977.1, the 2020 entry that has the correct information and matches IUIS isoform.

Related Articles

Pubmed Authors Title Journal
8556554 Shen,H.D.; Chua,K.Y.; Lin,W.L.; Hsieh,K.H.; Thomas,W.R. Molecular cloning and immunological characterization of the house dust mite allergen Der f 7 Clin. Exp. Allergy 25 (10), 1000-1006 (1995)
10779281 Shen,H.D.; Chua,K.Y.; Lin,K.L.; Hsieh,K.H.; Thomas,W.R. Molecular cloning of a house dust mite allergen with common antibody binding specificities with multiple components in mite extracts Clin. Exp. Allergy 23 (11), 934-940 (1993)
18220991 Thomas WR; Heinrich TK; Smith WA; Hales BJ Pyroglyphid house dust mite allergens. Protein Pept Lett. 2007;14(10):943-53