Allergen

AAB35977.1

Accession AAB35977.1
Species Dermatophagoides farinae
Common Name American house dust mite
Description bactericidal permeability-increasing like protein
IUIS Name Der f 7
Gi
Length 213
Year Adopted 2020H
Sequence >AAB35977.1 Allergen Der f 7; bactericidal permeability-increasing like protein [Dermatophagoides farinae]
MMKFLLIAAVAFVAVSADPIHYDKITEEINKAIDDAIAAIEQSETIDPMKVPDHADKFER
HVGIVDFKGELAMRNIEARGLKQMKRQGDANVKGEEGIVKAHLLIGVHDDIVSMEYDLAY
KLGDLHPTTHVISDIQDFVVALSLEISDEGNITMTSFEVRQFANVVNHIGGLSILDPIFG
VLSDVLTAIFQDTVRKEMTKVLAPAFKRELEKN
Parent Accession
Notes An older entry with the same accession number (entry date 2010) listed in
COMPARE 2019 was retired from the database; it had the wrong species listed.
Based on the review of PMID 8556554 during the PRP review of the
"Historic screenings" data, the information has now been corrected in the current entry.
PMIDS 10779281 and 18220991 were imported from the older entry but were
not reviewed by PRP on this cycle (January 2020).