Allergen

AAB35977.1

Accession AAB35977.1
External DB Link NCBI Protein
Species Dermatophagoides farinae
Common Name house dust mite
Description bactericidal permeability-increasing like
IUIS Name Der f 7
Length 213
Year Adopted 2020H
Sequence >AAB35977.1 Der f 7; bactericidal permeability-increasing like [Dermatophagoides farinae]
MMKFLLIAAVAFVAVSADPIHYDKITEEINKAIDDAIAAIEQSETIDPMKVPDHADKFER
HVGIVDFKGELAMRNIEARGLKQMKRQGDANVKGEEGIVKAHLLIGVHDDIVSMEYDLAY
KLGDLHPTTHVISDIQDFVVALSLEISDEGNITMTSFEVRQFANVVNHIGGLSILDPIFG
VLSDVLTAIFQDTVRKEMTKVLAPAFKRELEKN
Parent Accession
Notes An older entry with the same accession number (entry date 2010) listed in COMPARE 2019 was retired from the database; it had the wrong species listed. Based on the review of PMID 8556554 during the PRP review of the Historic screenings data the information has now been corrected in the current entry. PMIDS 10779281 and 18220991 were imported from the older entry but were not reviewed by PRP on this cycle (January 2020).

Related Articles

Pubmed Authors Title Journal
8556554 Shen,H.D.; Chua,K.Y.; Lin,W.L.; Hsieh,K.H.; Thomas,W.R. Molecular cloning and immunological characterization of the house dust mite allergen Der f 7 Clin. Exp. Allergy 25 (10), 1000-1006 (1995)
18220991 Thomas WR; Heinrich TK; Smith WA; Hales BJ Pyroglyphid house dust mite allergens. Protein Pept Lett. 2007;14(10):943-53
10779281 Shen,H.D.; Chua,K.Y.; Lin,K.L.; Hsieh,K.H.; Thomas,W.R. Molecular cloning of a house dust mite allergen with common antibody binding specificities with multiple components in mite extracts Clin. Exp. Allergy 23 (11), 934-940 (1993)