Allergen

AAB41308.1

Accession AAB41308.1
Species Juglans regia
Common Name English walnut
Description 2S albumin
IUIS Name Jug r 1
Gi 0001794252
Length 139
Year Adopted 2007
Sequence >AAB41308.1 Allergen Jug r 1; 2S albumin [Juglans regia]
AALLVALLFVANAAAFRTTITTMEIDEDIDNPRRRGEGCREQIQRQQNLNHCQYYLRQQS
RSGGYDEDNQRQHFRQCCQQLSQMDEQCQCEGLRQVVRRQQQQQGLRGEEMEEMVQSARD
LPNECGISSQRCEIRRSWF
Parent Accession