Allergen

AAB50883.1

Accession AAB50883.1
Species Myrmecia pilosula
Common Name Jumper ant
Description Myr p I=allergenic polypeptide {N-teminal} [Myrmecia pilosula=jumper ants, venom, Peptide Partial, 112 aa]
IUIS Name
Gi 0001911819
Length 112
Year Adopted 2007
Sequence >AAB50883.1 Putative Myr p I=allergenic polypeptide {N-teminal} [Myrmecia pilosula]
MKLSCLLLTLAIIFVLTIVHAPNVEAKDLADPESEAVGFADAFGEADAVGEADPNAGLGS
VFGRLARILGRVIPKVAKKLGPKVAKVLPKVMKEAIPMAVEMAKSQEEQQPQ
Parent Accession