Allergen

AAB58417.1

Accession AAB58417.1
Species Aedes aegypti
Common Name Yellow fever mosquito
Description unknown function
IUIS Name Aed a 3
Gi 0002114497
Length 253
Year Adopted 2007
Sequence >AAB58417.1 Allergen Aed a 3; unknown function [Aedes aegypti]
MKPLVKLFLLFCLVGIVLSRPMPEDEEPVAEGGDEETTDDAGGDGGEEENEGEEHAGDED
AGGEDTGKEENTGHEDAGEEDAGEEDAGEEDAEKEEGEKEDAGDDAGSDDGEEDSTGGDE
GEANAEDSKGSEKNDPADTYRQVVALLDKDTKVDHIQSEYLRSALNNDLQSEVRVPVVEA
IGRIGDYSKIQGCFKSMGKDVKKVISEEEKKFKSCMSKKKSEYQCSEDSFAAAKSKLSPI
TSKIKSCVSSKGR
Parent Accession