Powered by FoodRisk.org

Allergen

AAB72147.1

Accession AAB72147.1
Species Blattella germanica
Common Name German cockroach
Description allergen Bla g 5 [Blattella germanica]
Gi 0002326190
Length 200
Year Adopted 2011
Sequence >accession|AAB72147.1|Allergen allergen Bla g 5 [Blattella germanica]
YKLTYCPVKALGEPIRFLLSYGEKDFEDYRFQEGDWPNLKPSMPFGKTPVLEIDGKQTHQ
SVAISRYLGKQFGLSGKDDWENLEIDMIVDTISDFRAAIANYHYDADENSKQKKWDPLKK
ETIPYYTKKFDEVVKANGGYLAAGKLTWADFYFVAILDYLNHMAKEDLVANQPNLKALRE
KVLGLPAIKAWVAKRPPTDL