Allergen

AAC48691.1

Accession AAC48691.1
External DB Link NCBI Protein
Species Equus caballus
Common Name horse
Description lipocalin
IUIS Name Equ c 1
Length 187
Year Adopted 2011
Sequence >AAC48691.1 Equ c 1; lipocalin [Equus caballus]
MKLLLLCLGLILVCAQQEENSDVAIRNFDISKISGEWYSIFLASDVKEKIEENGSMRVFV
DVIRALDNSSLYAEYQTKVNGECTEFPMVFDKTEEDGVYSLNYDGYNVFRISEFENDEHI
ILYLVNFDKDRPFQLFEFYAREPDVSPEIKEEFVKIVQKRGIVKENIIDLTKIDRCFQLR
GNGVAQA
Parent Accession

Related Articles

Pubmed Authors Title Journal
11358533 Goubran Botros,H.; Poncet,P.; Rabillon,J.; Fontaine,T.; Laval,J.M.; David,B. Biochemical characterization and surfactant properties of horse allergens Eur. J. Biochem. 268 (10), 3126-3136 (2001)
8955138 Gregoire,C.; Rosinski-Chupin,I.; Rabillon,J.; Alzari,P.M.; David,B.; Dandeu,J.P. cDNA cloning and sequencing reveal the major horse allergen Equ c1 to be a glycoprotein member of the lipocalin superfamily J. Biol. Chem. 271 (51), 32951-32959 (1996)
10787420 Lascombe,M.B.; Gregoire,C.; Poncet,P.; Tavares,G.A.; Rosinski-Chupin,I.; Rabillon,J.; Goubran-Botros,H.; Mazie,J.C.; David,B.; Alzari,P.M. Crystal structure of the allergen Equ c 1. A dimeric lipocalin with restricted IgE-reactive epitopes J. Biol. Chem. 275 (28), 21572-21577 (2000)
8238811 Fjeldsgaard BE; Paulsen BS Comparison of IgE-binding antigens in horse dander and a mixture of horse hair and skin scrapings. Allergy. 1993 Oct;48(7):535-41
8308084 Dandeu JP; Rabillon J; Divanovic A; Carmi-Leroy A; David B Hydrophobic interaction chromatography for isolation and purification of Equ.cl, the horse major allergen. J Chromatogr. 1993 Nov 17;621(1):23-31
17517108 Immonen A; Kinnunen T; Sirven P; Taivainen A; Houitte D; Peräsaari J; Närvänen A; Saarelainen S; Rytkönen-Nissinen M; Maillere B; Virtanen T The major horse allergen Equ c 1 contains one immunodominant region of T cell epitopes. Clin Exp Allergy. 2007 Jun;37(6):939-47
18070162 Saarelainen S; Rytkönen-Nissinen M; Rouvinen J; Taivainen A; Auriola S; Kauppinen A; Kinnunen T; Virtanen T Animal-derived lipocalin allergens exhibit immunoglobulin E cross-reactivity. Clin Exp Allergy. 2008 Feb;38(2):374-81