Powered by FoodRisk.org

Allergen

AAC67308.1

Accession AAC67308.1
Species Schistosoma japonicum
Common Name Schistosoma
Description 22.6 kDa tegumental antigen [Schistosoma japonicum]
Gi 0002739154
Length 191
Year Adopted 2007
Sequence >accession|AAC67308.1|Putative 22.6 kDa tegumental antigen [Schistosoma japonicum]
MATTEYRLSLMEQFIRAFIEIDKDNNELIDKQELTKYCQQNQMDMKQIDPWIARFDTDKD
GKVSLEEFCRGFGLKVWEVRREKEELKKDKEGKVSTLPLDIQIIAATMSKAKQYNICCKF
KELLDKTSRTGDEVRAVANDLKAFLDSEYGRVWQVIILTGSYWMNFSHEPFLSMQFKYSN
YVCLLWRTPSS