Powered by FoodRisk.org

Allergen

AAD32205.1

Accession AAD32205.1
Species Prunus armeniaca
Common Name Apricot
Description Hev b 5 like acidic protein
IUIS Name Pru ar 5
Gi
Length 168
Year Adopted 2021
Sequence >AAD32205.1 Allergen Pru ar 5; Hev b 5 like acidic protein [Prunus armeniaca]
MATVEVAPAATLQENEAKTVEVIKTEEKTPEEPVAAAPAAVPESEAATT
EEPKETTPVEAEAEAEAEAPAAPEAETPVPAEVETKEVAEEPKAAEAEA
EEPAATETEKTEKTEAEEPKEVTAAEPVAAVAEETKEETTESAETPAAP
PAEEEKAEEATTDVPVEKTEE
Parent Accession